#chickenwing

Live, measured metrics for the hashtag #chickenwing from the open social web. Every number carries a named source and the time it was fetched. Nothing is estimated.

hashtag.org network · sponsored

Own #chickenwing

This #name is available to claim. It becomes your portal on the open agent web: this very page, a keyword you rank for by an open public stake, and a verifiable identity for AI agents. Nobody else sells a page like this for every #name.

$10.85/ year · 11-character #name
Claim #chickenwing — $10.85/yr→Buy on hashtag.space (web3)
card via hashtag.org · tokens via hashtag.space
0
Uses / 7 days
Mastodon
0
Accounts / 7 days
Mastodon
5
Recent posts
Mastodon
~0/hr
Recent pace
Mastodon · last 5
0
Avg reactions / post
Mastodon · last 5
—
Reddit posts / month
Reddit search
—
Open-web mentions
hashtag.org Firehose

Day-by-day usage

measured · fosstodon.org (Mastodon public tags API) · fetched 2026-10-19 14:27 UTC
0
10-13
0
10-14
0
10-15
0
10-16
0
10-17
0
10-18
0
10-19

0 uses by 0 unique accounts across the window. Real per-day counts, not estimates. Newest bar is today so far.

Related hashtags

measured · fosstodon.org (Mastodon public search API) · fetched 2026-10-19 14:27 UTC
#chickenwings
26 uses · 11 accounts / 7d
#chickenwingscolumbusga
0 uses · 0 accounts / 7d
#chickenwingsrecipe
0 uses · 0 accounts / 7d
#ChickenWingDeals
0 uses · 0 accounts / 7d
#chickenwingday
0 uses · 0 accounts / 7d
#chickenwingscomics
0 uses · 0 accounts / 7d
#chickenwings4mods
0 uses · 0 accounts / 7d
#chickenwingmarinade
0 uses · 0 accounts / 7d
#chickenwingcapital
0 uses · 0 accounts / 7d
#chickenwingrecipe
0 uses · 0 accounts / 7d
#chickenwingrecipesinafryingpan
0 uses · 0 accounts / 7d
#chickenwingrecipes
0 uses · 0 accounts / 7d

Live pulse

measured · fosstodon.org (Mastodon tag timeline) · fetched 2026-10-19 14:27 UTC

Everything below is measured over the latest 5 public posts (spanning ~29243 hours).

Posting hours (UTC)

00:0012:0023:00

Languages: English (3)

Avg boosts / post: 0.2

Top of the latest posts

  • "Here, have a wing!" #BirthdayPicnic #BbqWings #ChickenWing #Pollo #Food #Comida #Birthday #Event #EventPhotography #CanonPhotography #PaulThomasPhotography #Jamaica

    Paul Thomas Photography@[email protected]♥ 0↻ 02025-07-07 05:42 UTCView post →

  • ALMOST THERE!! They’re back in acetone to get rid of (hopefully) the last of the greasy spots. Then, when I can afford it, I’ll put them in 12% hydrogen peroxide for an even whiter color! #bones #skeleton #bird #dino #dinosaurbones #chicken

    Aurous Azhdarchid@[email protected]♥ 0↻ 12023-06-11 18:00 UTCView post →

  • Just tried Trader Joe's #Buffalo Style #Chickenless #Wings, and gotta say they are pretty tasty! Looks to be soy-based with a pea protein and rice flour breading, along with a bunch more ingredients for flavoring. And combined with the incl

    kcǃ@[email protected]♥ 0↻ 02023-05-11 21:39 UTCView post →

#chickenwing across platforms

every network with a public tag surface

Follow #chickenwing straight to each platform’s own tag page. Where a platform publishes open data we measure it above; the rest lock their numbers behind paid APIs, so we link rather than guess.

X (Twitter) ↗Instagram ↗TikTok ↗Facebook ↗LinkedIn ↗YouTube ↗Threads ↗Bluesky ↗Mastodon ↗Reddit ↗Pinterest ↗Tumblr ↗

Every number above is measured from a named public API at the shown fetch time. Nothing is estimated or extrapolated. Platforms that lock their data behind paid APIs are not shown. Agents: the same numbers, as JSON, at /api/hashtags/chickenwing